Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe ER-derived vesicles protein 41 (erv41)

This Recombinant Schizosaccharomyces pombe ER-derived vesicles protein 41 (erv41) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

ER-derived vesicles protein 41

UniProt

O94283

Expression Region

1-333

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRSRVPANIRAFDAFPKFSKEYRRQSSSRGGFFTILLSVLIVVLVFSQCVQYIRGIREQ ELFIYDSVSELMDLNIDITIAMPCSNLRIDVVDRTKDLVLATEALTLEEAFIKDMPTSST IYKNDRYAGLRWARTEKFRKKNNAEPGSGTACRIYGQLVVNRVNGQLHITAPGWGYGRSN IPFHSLNFTHYIEELSFGEYYPALVNALDGHYGHANDHPFAFQYYLSVLPTSYKSSFRSF ETNQYSLTENSVVRQLGFGSLPPGIFIDYDLEPLAVRVVDKHPNVASTLLRILAISGGLI TVASWIERVYSSRAHRSTSEADMLGLLGKSETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-100 1x 100 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details