Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacteroides fragilis UPF0365 protein BF1143 (BF1143)

This Recombinant Bacteroides fragilis UPF0365 protein BF1143 (BF1143) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

UPF0365 protein BF1143

UniProt

Q5LG75

Expression Region

1-333

Origin

Bacteroides fragilis (strain ATCC 25285 / NCTC 9343)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVEPMYLTIFLIAGGIIFLVLFFHYVPFFLWLSAKVSGVNISLVQLFLMRIRNVPPYII VPGMIEAHKAGLSNITRDELEAHYLAGGHVERVVHALVSASKANIELPFQMATAIDLAGR DVFEAVQMSVNPKVIDTPPVTAVAKDGIQLIAKARVTVRANIRQLVGGAGEDTILARVGE GIVSSIGSSENHKSVLENPDSISKLVLRKGLDAGTAFEILSIDIADIDIGKNIGAALQID QANADKNIAQAKAEERRAMAVATEQEMKAKAEEARANVIQAEAEVPKAMAEAFRSGNLGI MDYYKMKNIQADTSMRENIAKPIGGATSKPLSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-100 1x 100 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2422), CF568 conjugate, 0.1mg/mL
BNC682422-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2422), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF740 conjugate, 0.1mg/mL
BNC741731-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF514 conjugate, 0.1mg/mL
BNC142501-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2501), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details