Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acyl-CoA wax alcohol acyltransferase 2 (AWAT2)

This Recombinant Human Acyl-CoA wax alcohol acyltransferase 2 (AWAT2) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Acyl-CoA wax alcohol acyltransferase 2, EC= 2.3.1.75, Diacylglycerol O-acyltransferase 2-like protein 4, Diacylglycerol O-acyltransferase candidate 4, hDC4, Long-chain-alcohol O-f

UniProt

Q6E213

Expression Region

1-333

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLPSKKDLKTALDVFAVFQWSFSALLITTTVIAVNLYLVVFTPYWPVTVLILTWLAFDW KTPQRGGRRFTCVRHWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWFGHF ATEASGFSKIFPGITPYILTLGAFFWMPFLREYVMSTGACSVSRSSIDFLLTHKGTGNMV IVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIFTPGG FVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIV AKYHTLYIDALRKLFDQHKTKFGISETQELEII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-100 1x 100 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF568 conjugate, 0.1mg/mL
BNC681461-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF640R conjugate, 0.1mg/mL
BNC402076-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details