Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 129 (TMEM129)

This Recombinant Human Transmembrane protein 129 (TMEM129) spans the amino acid sequence from region 29-362.

Product Specifications

Product Name Alternative

Transmembrane protein 129

UniProt

A0AVI4

Expression Region

29-362

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGYYVGMCLAASEKRLHALSQ APEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTLALYALPQSGWQAVASSVNTE FRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHELSPDSNLPVQ LLTIRVASTNPAVQAFDIWLNSTEYGELCEKLRAPIRRAAHVVIHQSLGDLFLETFASLV EVNPAYSVPSSQELEACIGCMQTRASVKLVKTCQEAATGECQQCYCRPMWCLTCMGKWFA SRQDPLRPDTWLASRVPCPTCRARFCILDVCTVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse APRIL
6490 5 µg

Recombinant Mouse APRIL

Sign In for Pricing
View Details
Human Epigen (EPGN) activation kit by CRISPRa
GA116820 1 Kit

Human Epigen (EPGN) activation kit by CRISPRa

Sign In for Pricing
View Details
ATPase Activity Assay Kit
E-BC-K831-M 96 T (40 samples)

ATPase Activity Assay Kit

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-500 1x 500 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS506693 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
CREB3L1 (C-term) Rabbit Polyclonal Antibody
AP17243PU-N 400 µL

CREB3L1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details