Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mesoderm-specific transcript homolog protein (MEST)

This Recombinant Bovine Mesoderm-specific transcript homolog protein (MEST) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Mesoderm-specific transcript homolog protein, EC= 3.-.-.-, Paternally-expressed gene 1 protein

UniProt

Q2HJM9

Expression Region

1-335

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLSFHRVIALDFLGFGFSDKPRPHHYSI FEQASIVEALLRHLGLQSRRINLLSHDYGDTVAQELLYRFKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGMLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVSIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Skint8 Mouse Gene Knockout Kit (CRISPR)
KN515834 1 Kit

Skint8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
QuantiChrom™ Magnesium Assay Kit
DIMG-250 250 Tests

QuantiChrom™ Magnesium Assay Kit

Sign In for Pricing
View Details
Caspase-8 (p18) Recombinant Rabbit monoclonal Antibody
HA751031 100 µL

Caspase-8 (p18) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Abamectin A2a (>80%)
TRC-A107015-1MG 1 mg

Abamectin A2a (>80%)

Sign In for Pricing
View Details
LOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9A11]
TA500877AM 100 µL

LOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9A11]

Sign In for Pricing
View Details
2-(2,5-diaminophenyl)ethanol Sulfate
TRC-S699268-500MG 500 mg

2-(2,5-diaminophenyl)ethanol Sulfate

Sign In for Pricing
View Details