Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mesoderm-specific transcript homolog protein (MEST)

This Recombinant Bovine Mesoderm-specific transcript homolog protein (MEST) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Mesoderm-specific transcript homolog protein, EC= 3.-.-.-, Paternally-expressed gene 1 protein

UniProt

Q2HJM9

Expression Region

1-335

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLSFHRVIALDFLGFGFSDKPRPHHYSI FEQASIVEALLRHLGLQSRRINLLSHDYGDTVAQELLYRFKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGMLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVSIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O-Toluoyl Chloride
TRC-T536250-50G 50 g

O-Toluoyl Chloride

Sign In for Pricing
View Details
CD117 (KIT/982), CF405S conjugate, 0.1mg/mL
BNC040982-100 1x 100 µL

CD117 (KIT/982), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-(Boc-amino)-2-thiophenecarboxylic Acid
TRC-B809893-50MG 50 mg

3-(Boc-amino)-2-thiophenecarboxylic Acid

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179UM-02 100 µg

Elab Fluor® 647 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
CST6 (NM_001323) Human Over-expression Lysate
LC400530 20 µg

CST6 (NM_001323) Human Over-expression Lysate

Sign In for Pricing
View Details