Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0353 protein MAP_1207 (MAP_1207)

This Recombinant UPF0353 protein MAP_1207 (MAP_1207) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

UPF0353 protein MAP_1207

UniProt

Q740Y5

Expression Region

1-335

Origin

Mycobacterium paratuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLPFLGPMSLSGFEHSWFFLFLLVVAGLAALYILMQLARQRRMLRFANMELLESVAPKR PSTWRHLPAILLVASLVLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATDVAPNRMA AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEGI FTALQAIATVGAVIGGGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAASLQELKSVYATLQQQIGY ETIKGDASVGWVRLGALVLALAALTALLINRRLPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromo Polystyrene
H12516009.25G 25 g

Bromo Polystyrene

Sign In for Pricing
View Details
IN-Q6S09 (>90%)
TRC-I499615-5MG 5 mg

IN-Q6S09 (>90%)

Sign In for Pricing
View Details
hemoglobin subunit gamma 1 (HBG1) (NM_000559) Human Over-expression Lysate
LC400190 20 µg

hemoglobin subunit gamma 1 (HBG1) (NM_000559) Human Over-expression Lysate

Sign In for Pricing
View Details
(1Alpha,3Beta,10Alpha)-Cholesta-5,7-diene-1,3,25-triol
TRC-C431405-5MG 5 mg

(1Alpha,3Beta,10Alpha)-Cholesta-5,7-diene-1,3,25-triol

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Rat IgG2b, λ Isotype Control[G013B8]
AN00565P-01 20 Tests

PE/Elab Fluor® 594 Rat IgG2b, λ Isotype Control[G013B8]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Rat IgG2b, λ Isotype Control[G013B8]
AN00565P-02 100 Tests

PE/Elab Fluor® 594 Rat IgG2b, λ Isotype Control[G013B8]

Sign In for Pricing
View Details