Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mesoderm-specific transcript homolog protein (Mest)

This Recombinant Rat Mesoderm-specific transcript homolog protein (Mest) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Mesoderm-specific transcript homolog protein, EC= 3.-.-.-

UniProt

Q6P5P5

Expression Region

1-335

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKTSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHQYSI FEQASIVESLLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPTESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPINPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MolPure Magnetic Universal Viral DNA/RNA Kit
18521ES48 48 Tests (Bottle)

MolPure Magnetic Universal Viral DNA/RNA Kit

Sign In for Pricing
View Details
LLGL2 (N-term) Rabbit Polyclonal Antibody
AP12122PU-N 400 µL

LLGL2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2503), 1mg/mL
BNUM2503-50 1x 50 µL

CD73 (Immuno-Oncology Target) (NT5E/2503), 1mg/mL

Sign In for Pricing
View Details
TRIM47 Antibody
KC-20958-01 50 μL

TRIM47 Antibody

Sign In for Pricing
View Details
TRIM47 Antibody
KC-20958-02 100 µL

TRIM47 Antibody

Sign In for Pricing
View Details
TRIM47 Antibody
KC-20958-03 1 mL

TRIM47 Antibody

Sign In for Pricing
View Details