Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phaeosphaeria nodorum NADH-cytochrome b5 reductase 2 (MCR1)

This Recombinant Phaeosphaeria nodorum NADH-cytochrome b5 reductase 2 (MCR1) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

NADH-cytochrome b5 reductase 2, EC= 1.6.2.2, Mitochondrial cytochrome b reductase

UniProt

Q0U9W5

Expression Region

1-336

Origin

Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Septoria nodorum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFARQVIRPARQLQQHVRRYASEAPQSGGSSNGALYVGIGAAGLAGAYIYMRGGKPAAPL SEEANKVAAKVGGASKKAFTGGDQGFISLLLDKSEVVNHNTKKLTFKLPEPDMESGLPVT SAVITKYKGPEMEKPVIRPYTPVSDVDQQGTVDFIVKKYEKGPMSSHMHNMEPGQRLDIK GPIPKYPWSPNKHEHIALIAGGTGITPMWQTARAIFKNPEDKTKVTLVFGNISEEDILLK KEWEHLENTYPQRFRAFYVLDNPPESWQGGKGFITKELLKTVLPEPKEGEKVKIFVCGPP GMYKAISGGKKSPSDQGELDGYLKELGYSKDQVYKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-100 1x 100 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details