Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Abhydrolase domain-containing protein 13 (abhd13)

This Recombinant Xenopus laevis Abhydrolase domain-containing protein 13 (abhd13) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Abhydrolase domain-containing protein 13, EC= 3.-.-.-

UniProt

Q6IRP4

Expression Region

1-336

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKHWVLWSCAERWLLALASWSWGLCRICLLPLILTFNMYGGVILLLLIFVSIAGILFKF QDVLLYFPDQPSSSRLYIPMPTGIPHENIFIKTKDNIRLNLILLRYTGDNSSFSPTIIYF HGNAGNIGHRLPNALLMLVNLKVNLILVDYRGYGKSDGEPSEEGLYMDSEAVLDYVMTRP DIDKTKIILFGRSLGGAVAIHLASENAHRICALVLENTFLSIPHMASTLFSVLPMRYLPL WCYKNKFLSYRKIVQCRMPSLFISGLSDQLIPPFMMKQLYELSPSRTKRLAIFPDGTHND TWQCQGYFTALEQFIKELNSNHCPEANAKTSNVTII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-100 1x 100 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF594 conjugate, 0.1mg/mL
BNC940032-100 1x 100 µL

MUC2 (CCP58), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details