Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisomal membrane protein PEX16 (Pex16)

This Recombinant Mouse Peroxisomal membrane protein PEX16 (Pex16) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein PEX16, Peroxin-16, Peroxisomal biogenesis factor 16

UniProt

Q91XC9

Expression Region

1-336

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLRLLSLRYQEYVTRHPAATAQLETAVRGLSYLLAGRFSDSHELSELVYSASNLLVLL NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAK AVLRMLLLIWFKAGIQTSPPIVPLDRETQAQPLDGDHNPGSQEPSYVGKRSHRVVRTLQN SPSLHSRYWGAPQQREIRQKQQQEELSTPPTPLGLQETIAESLYIARPLLHLLSLGLWGQ RSWTPWLLSGVVDMTSLSLLSDRKNLTRRERLELRRRTILLLYYLLRSPFYDRFSEAKIL FLLQLLTDHIPGVGLVARPLMDYLPSWQKIYFYSWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Mouse IgG2b (subclass specific), conjugated with Horseradish peroxidase
GAM/IgG2b/PO 1 mL

Goat anti Mouse IgG2b (subclass specific), conjugated with Horseradish peroxidase

Sign In for Pricing
View Details
PCBD1 Rabbit pAb
E2506392 100 µL

PCBD1 Rabbit pAb

Sign In for Pricing
View Details
Ctdnep1 (NM_026017) Mouse Tagged Lenti ORF Clone
MR203038L3 10 µg

Ctdnep1 (NM_026017) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TCEB1P7 3'UTR Lenti-reporter-Luc Vector
46360081 1.0 µg

TCEB1P7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse ANGPTL4 Antibody, InVivo Block/Neutralizing Antibody
ANT-37445-1mg 1 mg

Mouse ANGPTL4 Antibody, InVivo Block/Neutralizing Antibody

Sign In for Pricing
View Details
PE Anti-human CD85 Antibody *17G10.2*
108501M0-AAT 25 Tests

PE Anti-human CD85 Antibody *17G10.2*

Sign In for Pricing
View Details