Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisomal membrane protein PEX16 (Pex16)

This Recombinant Mouse Peroxisomal membrane protein PEX16 (Pex16) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein PEX16, Peroxin-16, Peroxisomal biogenesis factor 16

UniProt

Q91XC9

Expression Region

1-336

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLRLLSLRYQEYVTRHPAATAQLETAVRGLSYLLAGRFSDSHELSELVYSASNLLVLL NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAK AVLRMLLLIWFKAGIQTSPPIVPLDRETQAQPLDGDHNPGSQEPSYVGKRSHRVVRTLQN SPSLHSRYWGAPQQREIRQKQQQEELSTPPTPLGLQETIAESLYIARPLLHLLSLGLWGQ RSWTPWLLSGVVDMTSLSLLSDRKNLTRRERLELRRRTILLLYYLLRSPFYDRFSEAKIL FLLQLLTDHIPGVGLVARPLMDYLPSWQKIYFYSWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyrrolidine-1-dithiocarboxylic acid ammonium salt
90033353-250g 250 g

Pyrrolidine-1-dithiocarboxylic acid ammonium salt

Sign In for Pricing
View Details
Rabbit Polyclonal Tryptophanyl tRNA synthetase Antibody
NBP2-32185 100 µL

Rabbit Polyclonal Tryptophanyl tRNA synthetase Antibody

Sign In for Pricing
View Details
OAT-3, BF700 conjugated
orb3000810 100 µL

OAT-3, BF700 conjugated

Sign In for Pricing
View Details
RBM3 Rabbit Polyclonal Antibody (BF488)
orb2407613 100 µL

RBM3 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
CFB Recombinant Protein
OPCD02158-50UG 50 µg

CFB Recombinant Protein

Sign In for Pricing
View Details
ELISA Kit For Leucine-rich repeat-containing G-protein coupled receptor 6
E4576m 96 Tests

ELISA Kit For Leucine-rich repeat-containing G-protein coupled receptor 6

Sign In for Pricing
View Details