Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 109B (CCDC109B)

This Recombinant Human Coiled-coil domain-containing protein 109B (CCDC109B) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 109B

UniProt

Q9NWR8

Expression Region

1-336

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQRGLWPWRTRLLPTPGTWRPARPWPLPPPPQVLRVKLCGNVKYYQSHHYSTVVPPDEI TVIYRHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMI SASTLMDILLMNDFKLVINKIAYDVQCPKREKPSNEHTAEMEHMKSLVHRLFTILHLEES QKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSEAKTSGLLWAGLALLSIQGGALAWLTW WVYSWDIMEPVTYFITFANSMVFFAYFIVTRQDYTYSAVKSRQFLQFFHKKSKQQHFDVQ QYNKLKEDLAKAKESLKQARHSLCLQMQVEELNEKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NPM1 Antibody
RC-4733-01 50 μL

Recombinant NPM1 Antibody

Sign In for Pricing
View Details
Recombinant NPM1 Antibody
RC-4733-02 100 µL

Recombinant NPM1 Antibody

Sign In for Pricing
View Details
Recombinant NPM1 Antibody
RC-4733-03 1 mL

Recombinant NPM1 Antibody

Sign In for Pricing
View Details
WDTC1 (NM_015023) Human Recombinant Protein
TP307453 20 µg

WDTC1 (NM_015023) Human Recombinant Protein

Sign In for Pricing
View Details
H-Lys(Boc)OMe hydrochloride
TRC-L487915-250MG 250 mg

H-Lys(Boc)OMe hydrochloride

Sign In for Pricing
View Details
Mouse MIγ/CXCL9 Antibody Pair Set
E-KAB-0303 50 µL & 100 µg

Mouse MIγ/CXCL9 Antibody Pair Set

Sign In for Pricing
View Details