Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 109B (CCDC109B)

This Recombinant Human Coiled-coil domain-containing protein 109B (CCDC109B) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 109B

UniProt

Q9NWR8

Expression Region

1-336

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQRGLWPWRTRLLPTPGTWRPARPWPLPPPPQVLRVKLCGNVKYYQSHHYSTVVPPDEI TVIYRHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMI SASTLMDILLMNDFKLVINKIAYDVQCPKREKPSNEHTAEMEHMKSLVHRLFTILHLEES QKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSEAKTSGLLWAGLALLSIQGGALAWLTW WVYSWDIMEPVTYFITFANSMVFFAYFIVTRQDYTYSAVKSRQFLQFFHKKSKQQHFDVQ QYNKLKEDLAKAKESLKQARHSLCLQMQVEELNEKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSAMP (NM_002338) Human Over-expression Lysate
LC400840 20 µg

LSAMP (NM_002338) Human Over-expression Lysate

Sign In for Pricing
View Details
NEK4 (C-term) Rabbit Polyclonal Antibody
AP15024PU-N 400 µL

NEK4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prominin 2 (PROM2) (NM_001165978) Human Over-expression Lysate
LY432052 100 µg

Prominin 2 (PROM2) (NM_001165978) Human Over-expression Lysate

Sign In for Pricing
View Details
TCEAL1 Human qPCR Primer Pair (NM_001006640)
HP231491 200 Reactions

TCEAL1 Human qPCR Primer Pair (NM_001006640)

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561406 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
HNRPLL (HNRNPLL) (NM_001142650) Human Over-expression Lysate
LC428233 20 µg

HNRPLL (HNRNPLL) (NM_001142650) Human Over-expression Lysate

Sign In for Pricing
View Details