Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 109B (CCDC109B)

This Recombinant Human Coiled-coil domain-containing protein 109B (CCDC109B) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 109B

UniProt

Q9NWR8

Expression Region

1-336

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQRGLWPWRTRLLPTPGTWRPARPWPLPPPPQVLRVKLCGNVKYYQSHHYSTVVPPDEI TVIYRHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMI SASTLMDILLMNDFKLVINKIAYDVQCPKREKPSNEHTAEMEHMKSLVHRLFTILHLEES QKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSEAKTSGLLWAGLALLSIQGGALAWLTW WVYSWDIMEPVTYFITFANSMVFFAYFIVTRQDYTYSAVKSRQFLQFFHKKSKQQHFDVQ QYNKLKEDLAKAKESLKQARHSLCLQMQVEELNEKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Stomach
CR560285 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB502452 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
BDKRB2 Human Gene Knockout Kit (CRISPR)
KN210378 1 Kit

BDKRB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thiamine Acetate Hydrochloride
TRC-T344075-50MG 50 mg

Thiamine Acetate Hydrochloride

Sign In for Pricing
View Details
Recombinant Human MYOZ1 protein (His tag)
PDEH101025-01 20 µg

Recombinant Human MYOZ1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MYOZ1 protein (His tag)
PDEH101025-02 100 µg

Recombinant Human MYOZ1 protein (His tag)

Sign In for Pricing
View Details