Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisomal membrane protein PEX16 (PEX16)

This Recombinant Human Peroxisomal membrane protein PEX16 (PEX16) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein PEX16, Peroxin-16, Peroxisomal biogenesis factor 16

UniProt

Q9Y5Y5

Expression Region

1-336

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLL NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAK AVLRMLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQN TPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYIARPLLHLLSLGLWGQ RSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARIL FLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm10639 siRNA Oligos set (Mouse)
21706174 3x 5 nmol

Gm10639 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Brevibacillus brevis Middle cell wall protein (BBR47_54160), partial
MBS1242974 Inquire

Recombinant Brevibacillus brevis Middle cell wall protein (BBR47_54160), partial

Sign In for Pricing
View Details
Brecanavir
524534 1.0mg

Brecanavir

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Cynomolgus CLEC12A / MICL / CLL-1 (65-265) Membrane Protein, PaRoom Temperatureial, His- tag
MP1066F Each

Magic™ Antibody Discovery - Cynomolgus CLEC12A / MICL / CLL-1 (65-265) Membrane Protein, PaRoom Temperatureial, His- tag

Sign In for Pricing
View Details
Nrip1 3'UTR Lenti-reporter-Luc Vector
32169086 1.0 µg

Nrip1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PADI2 Antibody, HRP conjugated
CSB-PA896493YB01HU-01 50 µg

PADI2 Antibody, HRP conjugated

Sign In for Pricing
View Details