Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisomal membrane protein PEX16 (PEX16)

This Recombinant Human Peroxisomal membrane protein PEX16 (PEX16) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein PEX16, Peroxin-16, Peroxisomal biogenesis factor 16

UniProt

Q9Y5Y5

Expression Region

1-336

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLL NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAK AVLRMLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQN TPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYIARPLLHLLSLGLWGQ RSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARIL FLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mapk14 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7546002 1.0 µg DNA

Mapk14 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Alg14 Rat Pre-designed siRNA Set A
HY-RS28910 1 Set

Alg14 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
SMARCA3, Control Peptide (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 3, DNA-binding Protein/plasminogen Activator Inhibitor 1 Regulator, Helicase-like Transcription Factor, HLTF, HLTF1, HIP116, HIP116A, RING Finger Protein 80, RNF80, Sucrose Nonfermenting Protein 2-like 3, SNF2L3, ZBU1)
148509 100 µg

SMARCA3, Control Peptide (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 3, DNA-binding Protein/plasminogen Activator Inhibitor 1 Regulator, Helicase-like Transcription Factor, HLTF, HLTF1, HIP116, HIP116A, RING Finger Protein 80, RNF80, Sucrose Nonfermenting Protein 2-like 3, SNF2L3, ZBU1)

Sign In for Pricing
View Details
3- (2,4-Difluorophenyl) -2-hydroxypropanenitrile
LIC70677-01 50 mg

3- (2,4-Difluorophenyl) -2-hydroxypropanenitrile

Sign In for Pricing
View Details
3- (2,4-Difluorophenyl) -2-hydroxypropanenitrile
LIC70677-02 0.5 g

3- (2,4-Difluorophenyl) -2-hydroxypropanenitrile

Sign In for Pricing
View Details
Mouse P2Y purinoceptor 4, P2ry4 ELISA KIT
ELI-35728m 96 Tests

Mouse P2Y purinoceptor 4, P2ry4 ELISA KIT

Sign In for Pricing
View Details