Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisomal membrane protein PEX16 (PEX16)

This Recombinant Human Peroxisomal membrane protein PEX16 (PEX16) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein PEX16, Peroxin-16, Peroxisomal biogenesis factor 16

UniProt

Q9Y5Y5

Expression Region

1-336

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLL NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAK AVLRMLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQN TPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYIARPLLHLLSLGLWGQ RSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARIL FLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD2, GST-tagged
CD2-10922H 25 µg

Recombinant Human CD2, GST-tagged

Sign In for Pricing
View Details
HPX sgRNA CRISPR Lentivector (Human) (Target 1)
K0988302 1.0 µg DNA

HPX sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Gm266 3'UTR Luciferase Stable Cell Line
TU107849 1.0 mL

Gm266 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
OTUB2 (Ubiquitin Thioesterase OTUB2, Deubiquitinating Enzyme OTUB2, OTU Domain-containing Ubiquitin Aldehyde-binding Protein 2, Otubain-2, Ubiquitin-specific-processing Protease OTUB2, C14orf137, OTB2, OTU2, FLJ21916, MGC3102) (AP) discontinued
130770-AP 100 µL

OTUB2 (Ubiquitin Thioesterase OTUB2, Deubiquitinating Enzyme OTUB2, OTU Domain-containing Ubiquitin Aldehyde-binding Protein 2, Otubain-2, Ubiquitin-specific-processing Protease OTUB2, C14orf137, OTB2, OTU2, FLJ21916, MGC3102) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Anti-Human MAPK3 pAb
PA4295-01 50 μL

Rabbit Anti-Human MAPK3 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human MAPK3 pAb
PA4295-02 100 μL

Rabbit Anti-Human MAPK3 pAb

Sign In for Pricing
View Details