Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant DnaJ homolog dnj-2 (dnj-2)

This Recombinant DnaJ homolog dnj-2 (dnj-2) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

DnaJ homolog dnj-2, DnaJ domain protein 2

UniProt

Q17433

Expression Region

1-337

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSAIAAPILFLLVSFFVQECESVGFAPELYCGLENCYDVLEVNREEFDKQKLAKAYRAL ARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTNYDYYLDHPDQRFYNYYQYYR LRAAPKVDLRIVIVGTILIISLFQFLSAKHKFSEAIEYATGVGKFRNMAIKDGIDKGLLE MDRNGKLKKNKGVDNDEVIKQIIIDNLDVTGGYKRESIYDTLAWHTIIFPLTIFRYIKWT ALWYWRFAIQKEEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKRNCATW KAERDAAEQEKMAQSGRYKRYKRYMKNAGTISFVDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC22 Human Gene Knockout Kit (CRISPR)
KN431491 1 Kit

MUC22 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®488A Conjugate - Biotium Choice
P038-488A-1ML 1x 1 mL

DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®488A Conjugate - Biotium Choice

Sign In for Pricing
View Details
Hornerin (HRNR) Human Gene Knockout Kit (CRISPR)
KN418662 1 Kit

Hornerin (HRNR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARL3 (N-term) Rabbit Polyclonal Antibody
AP12134PU-N 400 µL

ARL3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phactr4 Mouse Gene Knockout Kit (CRISPR)
KN513187 1 Kit

Phactr4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IFluor® 647 azide
1091-AAT 1 mg

IFluor® 647 azide

Sign In for Pricing
View Details