Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Abhydrolase domain-containing protein 13 (abhd13)

This Recombinant Danio rerio Abhydrolase domain-containing protein 13 (abhd13) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Abhydrolase domain-containing protein 13, EC= 3.-.-.-

UniProt

Q32LS6

Expression Region

1-337

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKPWRLWGPLEACLLSVCAWSWGFCRVSLLALILTFHLYGGFVLLGLILASLAGILYKF QDVLLYFPDQPSSSRLYVPMPTGIPHENVYIRTKDGIRLNLILLRYTGENPAGAPTILYF HGNAGNIGHRVPNALLMLVNLKANVVLVDYRGYGKSEGDPSEDGLYQDAEATLDYVMTRP DIDKTKVVLFGRSLGGAVAIRLASCNPHRVAAIMVENTFLSIPHMAATLFSFFPMRYLPL WCYKNKFLSYRHVVPCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPEGTHND TWQCQGYFSALEQFMKELLKSHAREETTQGTASVTII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-100 1x 100 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-100 1x 100 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details