Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Abhydrolase domain-containing protein 13 (Abhd13)

This Recombinant Mouse Abhydrolase domain-containing protein 13 (Abhd13) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Abhydrolase domain-containing protein 13, EC= 3.-.-.-

UniProt

Q80UX8

Expression Region

1-337

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKSWMLWSFIERWLLALASWSWALCRISLLPLIVTFHLYGGIVLLLLIFVSIAGILYKF QDVLLYFPEQPSSSRLYVPMPTGIPHENIFIRTKDGVRLNLILVRYTGDNSPYCPTIIYF HGNAGNIGHRLPNALLMLVNLRVNLVLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRP DLDKTKVFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPL WCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHND TWQCQGYFTALEQFIKEVIKSHSPEDMTKTSSNVTII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GARNL2P sgRNA CRISPR Lentivector (Human) (Target 1)
K0840802 1.0 µg DNA

GARNL2P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
OR4D11 (NM_001004706) Human Over-expression Lysate
LS219986 100 µg

OR4D11 (NM_001004706) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Brain derived neurotrophic facor,BDNF Elisa Kit
EK730078 96 Well

Mouse Brain derived neurotrophic facor,BDNF Elisa Kit

Sign In for Pricing
View Details
Lentiviral human BICC1 shRNA (UAS) - Lentiviral human BICC1 shRNA (UAS, iRFP) (100)
GTR15340614 1 Vial

Lentiviral human BICC1 shRNA (UAS) - Lentiviral human BICC1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Alpha1-Antichymotrypsin Antibody
orb1712692 7 mL

Alpha1-Antichymotrypsin Antibody

Sign In for Pricing
View Details
Rabbit Anti-BCAR1 antibody
SL6223R-01 50 µL

Rabbit Anti-BCAR1 antibody

Sign In for Pricing
View Details