Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Transmembrane protein 129 (tmem129)

This Recombinant Xenopus laevis Transmembrane protein 129 (tmem129) spans the amino acid sequence from region 25-362.

Product Specifications

Product Name Alternative

Transmembrane protein 129

UniProt

Q6IR55

Expression Region

25-362

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EFHSAGITVQNLLSGWLGSEDVAFVHYHIRRSSATLLAHSLLPMGYFIGMCFAAPEKELY NVHKAADGWKVFVLMAVLLPIATSILAFYWSQKRWSNHPLAKTLAHHALPQSSWRAVASS INTEFRRIDKFATGAPSARVIVTDTWVMKVTTYKVDVAQQQDIHLTVTDSRQHELSPDSN TPVQFITIRVASINPRVKPFDIRLNSTEYGELREKLHAPIRNAANIVIHQTLGDMFLDTF RSLVEANHTYEISSNQELEPCIGCMQTNANIKLVKYCQEANEGECQQCYCRPMWCLTCMG KWFASRQDQQHPETWLSSQVPCPTCRAKFCIVDVCIVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-100 1x 100 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (SOX10/2311R), CF740 conjugate, 0.1mg/mL
BNC742311-500 1x 500 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UACA / Nucling (AE-5), CF488A conjugate, 0.1mg/mL
BNC880956-100 1x 100 µL

UACA / Nucling (AE-5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (rKLC709), CF405S conjugate, 0.1mg/mL
BNC042050-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (rKLC709), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details