Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 129 (Tmem129)

This Recombinant Mouse Transmembrane protein 129 (Tmem129) spans the amino acid sequence from region 25-362.

Product Specifications

Product Name Alternative

Transmembrane protein 129

UniProt

Q8K304

Expression Region

25-362

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EFYSAGLTVQNLLSGWLGSEDAAFVPYHLRRTSATLLCHSLLPLGYYMGMCFAASEKQLY SPGQAPEAWQLFLLLAVTLPLLSCTLIYYWSWDRWTRHPLAQTLALYALPQSGWQAVASS INTEFRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHDLSPDSN LPVQLLTIRVASTSPGTQPFDIRLNSSEYGELCEKLHAPIRSAANVVIRQSLGDLFLETF ASHVEVNPAYSVPSNQELEPCIGCMQTRASVKLVKTCQEPAVGECQQCYCRPMWCLTCMG KWFASRQDPQRPDTWLASRVPCPTCRARFCILDVCCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCF1 Protein Vector (Human) (pPM-N-D-C-HA)
PV318856 500 ng

ABCF1 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Mouse Cstf1 qPCR Primer Pair
QM34006S 200 Tests

Mouse Cstf1 qPCR Primer Pair

Sign In for Pricing
View Details
FAK (Phospho-Tyr407) Antibody
MBS8509447-01 0.1 mg

FAK (Phospho-Tyr407) Antibody

Sign In for Pricing
View Details
FAK (Phospho-Tyr407) Antibody
MBS8509447-02 0.1 mL (AF635)

FAK (Phospho-Tyr407) Antibody

Sign In for Pricing
View Details
FAK (Phospho-Tyr407) Antibody
MBS8509447-03 0.1 mL (AF610)

FAK (Phospho-Tyr407) Antibody

Sign In for Pricing
View Details
FAK (Phospho-Tyr407) Antibody
MBS8509447-04 0.1 mL (AF405S)

FAK (Phospho-Tyr407) Antibody

Sign In for Pricing
View Details