Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 129 (Tmem129)

This Recombinant Mouse Transmembrane protein 129 (Tmem129) spans the amino acid sequence from region 25-362.

Product Specifications

Product Name Alternative

Transmembrane protein 129

UniProt

Q8K304

Expression Region

25-362

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EFYSAGLTVQNLLSGWLGSEDAAFVPYHLRRTSATLLCHSLLPLGYYMGMCFAASEKQLY SPGQAPEAWQLFLLLAVTLPLLSCTLIYYWSWDRWTRHPLAQTLALYALPQSGWQAVASS INTEFRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHDLSPDSN LPVQLLTIRVASTSPGTQPFDIRLNSSEYGELCEKLHAPIRSAANVVIRQSLGDLFLETF ASHVEVNPAYSVPSNQELEPCIGCMQTRASVKLVKTCQEPAVGECQQCYCRPMWCLTCMG KWFASRQDPQRPDTWLASRVPCPTCRARFCILDVCCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human POR protein
ATGP4107-500 500 µg

Recombinant human POR protein

Sign In for Pricing
View Details
Guinea pig Cytoskeleton-associated protein 5 (CKAP5) ELISA Kit
MBS7230463-01 48 Well

Guinea pig Cytoskeleton-associated protein 5 (CKAP5) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cytoskeleton-associated protein 5 (CKAP5) ELISA Kit
MBS7230463-02 96 Well

Guinea pig Cytoskeleton-associated protein 5 (CKAP5) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cytoskeleton-associated protein 5 (CKAP5) ELISA Kit
MBS7230463-03 5x 96 Well

Guinea pig Cytoskeleton-associated protein 5 (CKAP5) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cytoskeleton-associated protein 5 (CKAP5) ELISA Kit
MBS7230463-04 10x 96 Well

Guinea pig Cytoskeleton-associated protein 5 (CKAP5) ELISA Kit

Sign In for Pricing
View Details
SHP2 Rabbit mAb
MBS4763706-01 0.1 mL

SHP2 Rabbit mAb

Sign In for Pricing
View Details