Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus furiosus UPF0252 protein PF1496 (PF1496)

This Recombinant Pyrococcus furiosus UPF0252 protein PF1496 (PF1496) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

UPF0252 protein PF1496

UniProt

Q8U0T6

Expression Region

1-338

Origin

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKELDQILEKCAEEIDPLSHEIAERIRKLKNLPKDEMFLEYLRIIDFTSTTKIPWRKKNY ILIILWKYGEKIERLLYSRLEHFGRANVPKRYFRLVDGKILSMLFLVFILFPAFTSHIWS FRLGYEEIQVGKEITFNENLCEYRTAWLYDFKASMVCTIKYGYGKVNIRLNSTNPMEAGV EVQRFISQIPYDYARLESGFSYIQTPRETIGRRIGVCSDFAILTAQVLLDNNVSPVYIIH TLFKGDITGGHATAALFINGTLWIFDWGSAPVTFSEYLDTIDRLWEVREVRVYRLTESSI VLDRVYKGEPESDAWRYVYTLTMLIGIFIIKRREWLWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILIP1 (VSNL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B3]
TA802027BM 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B3]

Sign In for Pricing
View Details
MBBr [Monobromobimane] *CAS 71418-44-5*
633-AAT 25 mg

MBBr [Monobromobimane] *CAS 71418-44-5*

Sign In for Pricing
View Details
Human MYT1L activation kit by CRISPRa
GA107992 1 Kit

Human MYT1L activation kit by CRISPRa

Sign In for Pricing
View Details
CYP3A43 Rabbit Polyclonal Antibody
TA370047 100 µL

CYP3A43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERp57 (PDIA3) Goat Polyclonal Antibody
AB0003-500 1 mg

ERp57 (PDIA3) Goat Polyclonal Antibody

Sign In for Pricing
View Details
CD68 Mouse Monoclonal Antibody [Clone ID: SPM130]
AM50195PU-S 100 µg

CD68 Mouse Monoclonal Antibody [Clone ID: SPM130]

Sign In for Pricing
View Details