Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis serovar B Deubiquitinase and deneddylase Dub2 (cdu2)

This Recombinant Chlamydia trachomatis serovar B Deubiquitinase and deneddylase Dub2 (cdu2) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Deubiquitinase and deneddylase Dub2, ChlaDub2, EC= 3.4.22.-

UniProt

C4PQQ9

Expression Region

1-339

Origin

Chlamydia trachomatis serovar B (strain Jali20/OT)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPIHNPPPQTCSYSRPSTTYTSFKDASCGTKVTRIIIALFLIVISCGLILCAYTFRDLL DADYSAQEGPQQATKLLQQLDKVLTGPPLPIWDNEHLFQFSCLMQNKHRRVLPIDICNPL TKFNFLEYICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSA DTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEHRCVTFFDSFYNYIASPQQMREQLEGLA ASLGAIYPKEGGSDSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFD LEEKVPTNPSERRALLADFISTTEQAMSRYSSLSWPTTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-500 1x 500 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-100 1x 100 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-100 1x 100 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details