Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2609c (Mb2609c)

This Recombinant Uncharacterized protein Mb2609c (Mb2609c) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2609c

UniProt

P65024

Expression Region

1-340

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWARQAVAVNGMPVDDGALPGLQRIGLVRSVRAPQFDGITFHEVLCKSALNKVPNAAAL PFRYTVNGYRGCSHACRYCFARPTHEYLDFNPGTDFDTQVVVKTNVAAVLRHELRRPSWR RETVALGTNTDPYQRAEGRYALMPGIIGALAASGTPLSILTKGTLLRRDLPLIAEAAQQV PVSVAVSLAVGDPELHRDVESGTPTPQARLALITAIRAAGLDCHVMVAPVLPQLTDSGEH LDQLLGQIAAAGATGVTVFGLHLRGSTRGWFMCWLARAHPELVSRYRELYRRGPYLPPSY REMLRERVAPLIAKYRLAGDHRPAPPETEAALVPVQATLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC2 Rabbit Polyclonal Antibody (PE-Cy5)
orb869372 100 µL

RCC2 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Regucalcin Rabbit Polyclonal Antibody (Cy3)
orb988407 100 µL

Regucalcin Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Mouse Age 14 Days Skin Tissue Lysate
IMS14SKNTL100UG 1 Each

Mouse Age 14 Days Skin Tissue Lysate

Sign In for Pricing
View Details
Recombinant Treponema pallidum Lipoprotein signal peptidase (lspA)
orb2919260-01 20 µg

Recombinant Treponema pallidum Lipoprotein signal peptidase (lspA)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Lipoprotein signal peptidase (lspA)
orb2919260-02 100 µg

Recombinant Treponema pallidum Lipoprotein signal peptidase (lspA)

Sign In for Pricing
View Details
ARF5, Recombinant, Human, aa1-180, His-Tag (ADP-ribosylation factor 5)
A0901-86-01 100 µg

ARF5, Recombinant, Human, aa1-180, His-Tag (ADP-ribosylation factor 5)

Sign In for Pricing
View Details