Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2609c (Mb2609c)

This Recombinant Uncharacterized protein Mb2609c (Mb2609c) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2609c

UniProt

P65024

Expression Region

1-340

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWARQAVAVNGMPVDDGALPGLQRIGLVRSVRAPQFDGITFHEVLCKSALNKVPNAAAL PFRYTVNGYRGCSHACRYCFARPTHEYLDFNPGTDFDTQVVVKTNVAAVLRHELRRPSWR RETVALGTNTDPYQRAEGRYALMPGIIGALAASGTPLSILTKGTLLRRDLPLIAEAAQQV PVSVAVSLAVGDPELHRDVESGTPTPQARLALITAIRAAGLDCHVMVAPVLPQLTDSGEH LDQLLGQIAAAGATGVTVFGLHLRGSTRGWFMCWLARAHPELVSRYRELYRRGPYLPPSY REMLRERVAPLIAKYRLAGDHRPAPPETEAALVPVQATLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-3154 miRNA Antagomir
MNM01834 2x 5.0 nmol

mmu-miR-3154 miRNA Antagomir

Sign In for Pricing
View Details
BLNK Rabbit Polyclonal Antibody (APC)
orb1006580 100 µL

BLNK Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
TNM-FH Medium for Insect Cells (No Glucose)
abx705176 500 mL

TNM-FH Medium for Insect Cells (No Glucose)

Sign In for Pricing
View Details
VEGF Receptor 2/KDR Rabbit Polyclonal Antibody
orb137868 100 µg

VEGF Receptor 2/KDR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GM-CSF/CSF2 Antibody Picoband® (Biotine Conjugate)
PB9003-Biotin 100 µg/Vial

Anti-GM-CSF/CSF2 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Rno-miR-130b-3p miRNA Mimic
orb1874157-01 5 nmol

Rno-miR-130b-3p miRNA Mimic

Sign In for Pricing
View Details