Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Proline-rich transmembrane protein 2 (PRRT2)

This Recombinant Pongo abelii Proline-rich transmembrane protein 2 (PRRT2) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 2

UniProt

Q5RAC1

Expression Region

1-340

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASSSEISEMKGVEESPEVPGEGPGHSEAETGPPQVLAGVPDQPEALQPGPDTTAALVD SGPKAELAPETTETPAGASETAQATDLSLSPGGESKANCSPEDLCQETVSKPEVSKETTA DQGSRLESAAPPEPAPEPAPQPDPQPDSQPTPKPALQPELPTQEDPTPEILSESVGEKQE NGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMGRAHSGHPGSPR GSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMSRNSLQQ GDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kctd6 Mouse qPCR Primer Pair (NM_027782)
MP211261 200 Reactions

Kctd6 Mouse qPCR Primer Pair (NM_027782)

Sign In for Pricing
View Details
Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0048230-01 10 µg

Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0048230-02 50 µg

Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0048230-03 100 µg

Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0048230-04 200 µg

Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0048230-05 500 µg

Recombinant Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details