Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich transmembrane protein 2 (PRRT2)

This Recombinant Human Proline-rich transmembrane protein 2 (PRRT2) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 2

UniProt

Q7Z6L0

Expression Region

1-340

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASSSEISEMKGVEESPKVPGEGPGHSEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVD SGPKAGLAPETTETPAGASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATA DQGSRLESAAPPEPAPEPAPQPDPRPDSQPTPKPALQPELPTQEDPTPEILSESVGEKQE NGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPR GSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMSRNSLQQ GDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS801484 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Tenovin 6 Hydrochloride
TRC-T018475-5MG 5 mg

Tenovin 6 Hydrochloride

Sign In for Pricing
View Details
CHFR Human Gene Knockout Kit (CRISPR)
KN415377 1 Kit

CHFR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG,
AAF-531-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG,

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS626926 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF488A conjugate, 0.1mg/mL
BNC882197-500 1x 500 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details