Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich transmembrane protein 2 (PRRT2)

This Recombinant Human Proline-rich transmembrane protein 2 (PRRT2) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 2

UniProt

Q7Z6L0

Expression Region

1-340

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASSSEISEMKGVEESPKVPGEGPGHSEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVD SGPKAGLAPETTETPAGASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATA DQGSRLESAAPPEPAPEPAPQPDPRPDSQPTPKPALQPELPTQEDPTPEILSESVGEKQE NGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPR GSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMSRNSLQQ GDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEAD3 Polyclonal Antibody
E-AB-52887-01 20 µL

TEAD3 Polyclonal Antibody

Sign In for Pricing
View Details
TEAD3 Polyclonal Antibody
E-AB-52887-02 60 µL

TEAD3 Polyclonal Antibody

Sign In for Pricing
View Details
TEAD3 Polyclonal Antibody
E-AB-52887-03 120 µL

TEAD3 Polyclonal Antibody

Sign In for Pricing
View Details
TEAD3 Polyclonal Antibody
E-AB-52887-04 200 µL

TEAD3 Polyclonal Antibody

Sign In for Pricing
View Details
VEGFC (Center) Rabbit Polyclonal Antibody
AP11908PU-N 400 µL

VEGFC (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAM2 Rabbit Polyclonal Antibody
TA362299 100 µL

TRAM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details