Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

This Recombinant Pseudomonas fluorescens Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, EC= 2.7.8.30, Undecaprenyl-phosphate Ara4FN transferase, Ara4FN transferase

UniProt

Q3KCC2

Expression Region

1-340

Origin

Pseudomonas fluorescens (strain Pf0-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRPYPIHCVSIVIPVYNEEDSLPELLRRTEAACKQLRHDYEIVLVDDGSRDASAQLLEEA ASVVDSPFVAVILNRNYGQHAAIMAGFEQCKGDVVITLDADLQNPPEEIPRLVAEAEKGF DVVGTVRGNRQDSALRRYPSKLINLAVQRSTGVAMSDYGCMLRAYRRTIIDAMLACRERS TFIPILANSFARHTTEIPVAHAEREHGDSKYSPMRLINLMFDLITCMTTTPLRLLSIVGF AMAGLGVLFAAALIFMRLAFGAGWAGDGLFVLFAVLFVFTGGQFIGMGLLGEYLGRMYSD VRARPRFFIEKVLRGHPATPAPAITVDGLTSNSTSDQVLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
BNC880994-100 1x 100 µL

TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (MITF/915), CF640R conjugate, 0.1mg/mL
BNC400915-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (MITF/915), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (COL-1), CF740 conjugate, 0.1mg/mL
BNC740002-100 1x 100 µL

CD66 (CEA) (COL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details