Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Peroxisomal membrane protein PEX16 (pex16)

This Recombinant Xenopus laevis Peroxisomal membrane protein PEX16 (pex16) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein PEX16, Peroxin-16, Peroxisomal biogenesis factor 16

UniProt

Q6INN0

Expression Region

1-340

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAARYWDKLRDLSQKYKEYVIQNPTGATQLESGVRMLSYLIAGRFADSHELSELVYSSSN LLALLNDGILRKELLTPPPTEGSRRRLLTWLGVLESLEVFIEIGAARAWGERSRWAAILI IQLLKACLRIVLLFWYRVGIQSSPPVTPLDREGILNQAEDNSKSSSSCFVGRRSSRAVRS LNDSASSHRRFWRSPQIHEGKQQKNGETENDKEGSELGTLGTLAEAIHILRPITHLLSLA ACGQKSWKPWMMAAALDITSISLLSDVRNLSRRERIELRRRMFLLLYYLLRSPFYNNYTE TRLLLLLRLLGDYVPGLGLVARPLMDYLPVWQKIYFYNWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details