Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ydjG (ydjG)

This Recombinant Bacillus subtilis Uncharacterized protein ydjG (ydjG) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Uncharacterized protein ydjG

UniProt

O34434

Expression Region

1-341

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIISYKCPNCGSDMAFDSETGSLSCSSCGRQDNIESLPKENIAARFSDDEAKEYQCKNCG AVLITEAETTATTCSFCGGAAILADRLSGHLAPAKVIPFTISKQEAEQAFRKWCKKGLLT PRGFMSADRIKSITGMYIPFWMFDLNSEVQVRANCTRVHQYEEGDYICTETEHFEAFRDI NLDYLKIPVDASEKMKDELMDKLEPYSYEELKDFQTAYLAGYIAEKYNYTDEELFPRAKE KISSYIDSYIHSTFSGYTSVNVRDKHIHTKNVNSFYVLLPVWMVSYDYERAEHIFAMNGQ TGKVVGKPPISRGKVAAWFSGIAGGTFLALKLVSLMMGGGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-1 beta ELISA Kit (DIY Antibody Pairs)
orb1098186 5 Plate

Human IL-1 beta ELISA Kit (DIY Antibody Pairs)

Sign In for Pricing
View Details
IA-PEG-Mal, 600
HE018022-600 Inquire

IA-PEG-Mal, 600

Sign In for Pricing
View Details
Trp53bp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K5004407 1.0 µg DNA

Trp53bp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal PST1 Antibody
NBP2-41063-0.025mg 0.025 mg

Rabbit Polyclonal PST1 Antibody

Sign In for Pricing
View Details
SLC10A4 antibody
70R-6295 50 ug

SLC10A4 antibody

Sign In for Pricing
View Details
LILRB3 Protein Vector (Mouse) (pPM-C-His)
PV196625 500 ng

LILRB3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details