Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ydjG (ydjG)

This Recombinant Bacillus subtilis Uncharacterized protein ydjG (ydjG) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Uncharacterized protein ydjG

UniProt

O34434

Expression Region

1-341

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIISYKCPNCGSDMAFDSETGSLSCSSCGRQDNIESLPKENIAARFSDDEAKEYQCKNCG AVLITEAETTATTCSFCGGAAILADRLSGHLAPAKVIPFTISKQEAEQAFRKWCKKGLLT PRGFMSADRIKSITGMYIPFWMFDLNSEVQVRANCTRVHQYEEGDYICTETEHFEAFRDI NLDYLKIPVDASEKMKDELMDKLEPYSYEELKDFQTAYLAGYIAEKYNYTDEELFPRAKE KISSYIDSYIHSTFSGYTSVNVRDKHIHTKNVNSFYVLLPVWMVSYDYERAEHIFAMNGQ TGKVVGKPPISRGKVAAWFSGIAGGTFLALKLVSLMMGGGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Polymerase gamma (POLG) (829-1201) Rabbit Polyclonal Antibody
AP23095PU-N 50 µL

DNA Polymerase gamma (POLG) (829-1201) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF)
MBS7009749-01 0.02 mg

Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF)
MBS7009749-02 0.1 mg

Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF)
MBS7009749-03 5x 0.1 mg

Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Recombinant Mycobacterium Smegmatis mshD Protein (aa 1-295)
VAng-Yyj4706-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Smegmatis mshD Protein (aa 1-295)

Sign In for Pricing
View Details
Canine P-Selectin Glycoprotein Ligand 1 ELISA Kit
MBS006174-01 48 Well

Canine P-Selectin Glycoprotein Ligand 1 ELISA Kit

Sign In for Pricing
View Details