Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ydjJ (ydjJ)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ydjJ (ydjJ) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydjJ

UniProt

O34733

Expression Region

1-341

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEGYIIAGLLLLTAGMIDFLWTTLWLESGAGPITRCLSAWLWKGCRKISGDHAKVLSMA GPLLLCLTLVIWISLFWSGWVLIYSSDPHSLMETQSKEPASWSDRIYFSGYVMFTLGNGD LAPNGGLWKLVTIIETAQGLLTITFSVTYLISVLSAVNQKRSFAQSVLSLGHDGTEIVHN AWNGKDFHDIDFLLVAASSELGKLTAQHNAFPILHFYHSTQHQESSIIAVAVLDEALTIF KYGIPEQYQPNQLHIKEARSSIKNYLDTVHTAYIHPAEQAPPEPDISKLQQSGIPALSKQ TFQIAVNSIKERRQLLLGIIQAGARKWPVQEQAIGNAYSPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F8]
TA502799BM 100 µL

FGFR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F8]

Sign In for Pricing
View Details
CARD10 Human Gene Knockout Kit (CRISPR)
KN217652LP 1 Kit

CARD10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8/803), CF647 conjugate, 0.1mg/mL
BNC470803-100 1x 100 µL

Cytokeratin 8 (KRT8/803), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DLX4 Mouse Monoclonal Antibody [Clone ID: OTI7C8]
CF808592 100 µg

DLX4 Mouse Monoclonal Antibody [Clone ID: OTI7C8]

Sign In for Pricing
View Details
SUMO-1 (SUMO1/1188), CF647 conjugate, 0.1mg/mL
BNC471188-500 1x 500 µL

SUMO-1 (SUMO1/1188), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (111-1C5), CF740 conjugate, 0.1mg/mL
BNC741038-500 1x 500 µL

CD45RA (111-1C5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details