Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Inositol monophosphatase 3 (impad1)

This Recombinant Danio rerio Inositol monophosphatase 3 (impad1) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Inositol monophosphatase 3, IMP 3, IMPase 3, EC= 3.1.3.25, Inositol monophosphatase domain-containing protein 1, Inositol-1 (or 4) -monophosphatase 3, Myo-inositol

UniProt

Q2YDR3

Expression Region

1-341

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPMGIRLSPLGIAVFCLLGVGVIYHLYAGVLSSRLAFFRQKRTVDLRELLALSIDAAVQ GGREVKRIREDNTLEEKSKGKTKEGASEKYTLGDLNSHRKMYYLIKNTFPNIQVNSEEHA NAEGEATVWTRMIPEDILAKVSGGKEIPAEKITVWIDPLDATQEYTENLLKYVTTMVCVA VDGEPVIGVIHKPFTGYTVWGFVGEGSNVAPRDSYNTNSPKVIVSRSHAGKVKSFVQTAF GNNTEIIPAGGAGYKALALLNPTDDKQETADIYIHVTYIKKWDICAGDAILKSLGGQMTT LKGEQIDYSGLEGNKGGLLASMKVDHKALVKRLPLWEDNKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-100 1x 100 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-500 1x 500 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF568 conjugate, 0.1mg/mL
BNC682748-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details