Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable protease sohB (sohB)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable protease sohB (sohB) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Probable protease sohB, EC= 3.4.21.-

UniProt

Q8K9P8

Expression Region

1-342

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLLLNYELFLAKAITFLFIIFITPFIFNIIKRKRTDQKKFKIILLEEKYKNIKKDILLS KMNKLEKKKWIKEEKKKDKEFEKKNKNNIVTLKKKTLFVLDFKGGIHAHEVIGLREEISA ILLAANKDDEVLLRLESSGGVIHGYGLAAAQLERLRQNKIRLIISIDKIAASGGYMMACV ADYIISAPFAIIGSIGVVGQLPNFNKLLKKCNIDVELHTAGDYKRTLTMFGQNTELTRKK FCQELNLTHEIFKKFIKKMRPCLDIENISNGEHWFGTIAFKKNLVDEINTSDNILMSKMK EKYTLLNIQYIYKNKKLENFTSFIIENIKIIIIKIFSYKKIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-100 1x 100 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-500 1x 500 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF640R conjugate, 0.1mg/mL
BNC402200-500 1x 500 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PD7/26), CF647 conjugate, 0.1mg/mL
BNC470472-100 1x 100 µL

CD45RB (PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3 + CC49), CF405S conjugate, 0.1mg/mL
BNC040738-500 1x 500 µL

TAG-72 / CA72.4 (B72.3 + CC49), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details