Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Outcome predictor in acute leukemia 1 (OPA1L)

This Recombinant Human Outcome predictor in acute leukemia 1 (OPA1L) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Outcome predictor in acute leukemia 1

UniProt

Q9NX94

Expression Region

1-342

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFLLGLRQDKEACVGTNNQSYICDTGHCCGQSQCCNYYYELWWFWLVWTIIIILSCCCV CHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRFLPNYLLPPYEEVVNRPPTPPP PYSAFQLQQQQLLPPQCGPAGGSPPGIDPTRGSQGAQSSPLSEPSRSSTRPPSIADPDPS DLPVDRAATKAPGMEPSGSVAGLGELDPGAFLDKDAECREELLKDDSSEHGAPDSKEKTP GRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLC QSSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-100 1x 100 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-500 1x 500 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF405S conjugate, 0.1mg/mL
BNC042220-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/839), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM1170), CF405S conjugate, 0.1mg/mL
BNC041170-100 1x 100 µL

Vimentin (VM1170), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details