Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative glycosyltransferases (pimF)

This Recombinant Putative glycosyltransferases (pimF) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Putative glycosyltransferases, EC= 2.4.-.-

UniProt

P71781

Expression Region

1-342

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLSIVTTMYMSEPYVLEFYRRARAAADKITPDVEIIFVDDGSPDAALQQAVSLLDSDPC VRVIQLSRNFGHHKAMMTGLAHATGDLVFLIDSDLEEDPALLEPFYEKLISTGADVVFGC HARRPGGWLRNFGPKIHYRASALLCDPPLHENTLTVRLMTADYVRSLVQHQERELSIAGL WQITGFYQVPMSVNKAWKGTTTYTFRRKVATLVDNVTSFSNKPLVFIFYLGAAIFIISSS AAGYLIIDRIFFRALQAGWASVIVSIWMLGGVTIFCIGLVGIYVSKVFIETKQRPYTIIR RIYGSDLTTREPSSLKTAFPAAHLSNGKRVTSEPEGLATGNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1A Rabbit mAb
orb1563945-01 20 ul

ATP6V1A Rabbit mAb

Sign In for Pricing
View Details
ATP6V1A Rabbit mAb
orb1563945-02 50 µL

ATP6V1A Rabbit mAb

Sign In for Pricing
View Details
ATP6V1A Rabbit mAb
orb1563945-03 100 µL

ATP6V1A Rabbit mAb

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 23 (FGF-23) ELISA Kit
JL10444-01 48 Tests

Human Fibroblast Growth Factor 23 (FGF-23) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 23 (FGF-23) ELISA Kit
JL10444-02 96 Tests

Human Fibroblast Growth Factor 23 (FGF-23) ELISA Kit

Sign In for Pricing
View Details
Anti-Prostate Specific Acid Phosphatase (PSAP) Recombinant Mouse Monoclonal Antibody (Clone:rACPP/1338)
12-1239-20 20 µg

Anti-Prostate Specific Acid Phosphatase (PSAP) Recombinant Mouse Monoclonal Antibody (Clone:rACPP/1338)

Sign In for Pricing
View Details