Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Putative ALA-interacting subunit 2 (ALIS2)

This Recombinant Arabidopsis thaliana Putative ALA-interacting subunit 2 (ALIS2) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Putative ALA-interacting subunit 2, AtALIS2

UniProt

Q67YS6

Expression Region

1-343

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMEVEGSMNRAPDQSSFLRSRRSKALYQFKQQKLPACKPVLTPISVITVFMLMGFVFIPI GLITLRASRDAIEIIDRYDVECIPEEYRTNKLLYITDSSIPKNCTRYLKVQKYMKAPIFI YYQLDNYYQNHRRYVKSRSDQQLLHGLEYSHTSSCEPEESSNGLPIVPCGLIAWSMFNDT FTFSRERTKLNVSRNNIAWKSDREHKFGKNVYPINFQNGTLIGGAKLDPKIPLSDQEDFI VWMRAAALLSFRKLYGRIEEDLEPGKVVEVNLMNNYNTYSFSGQKKLILSTSNWLGGRND FLGITYLVVGSSSIVISIIFMLLHLKNPRPYGDNSWNKKSLSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANP32BP2 Protein Vector (Human) (pPM-C-HA)
12056021 500 ng

ANP32BP2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
RSS Recombinant Protein (Human)
RP095607 100 µg

RSS Recombinant Protein (Human)

Sign In for Pricing
View Details
Yellowfever mosquito prospero Rabbit Polyclonal Antibody (Fluoro647)
orb3088621 200 µL

Yellowfever mosquito prospero Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
GNG2 (NM_001243774) Human Tagged ORF Clone
RC231539 10 µg

GNG2 (NM_001243774) Human Tagged ORF Clone

Sign In for Pricing
View Details
ADAM 17 (pT735) Antibody
abx011977 100 µg

ADAM 17 (pT735) Antibody

Sign In for Pricing
View Details
Tubulin, beta
338488 100 µL

Tubulin, beta

Sign In for Pricing
View Details