Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C9orf4 (C9orf4)

This Recombinant Human Uncharacterized protein C9orf4 (C9orf4) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Uncharacterized protein C9orf4, Brain protein CG-6

UniProt

Q9P0K9

Expression Region

1-344

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRPRQGGGGAGGSAAARARAGGLGGGSVPARARGAPAAARAAWLRDLCARMARPPRQHP GVWASLLLLLLTGPAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGE FYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETCDYFLSYRMIG ADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRVRIQHFYNVGQWAKEIQRNP ARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYLFAWGPAIQGSITRHDIDSPPA SERVVSIYKYEDIFMPSAAYQTFSSPFCLLLIVALTFYLLMGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf61 (FAM189A2) Human Gene Knockout Kit (CRISPR)
KN415078 1 Kit

C9orf61 (FAM189A2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pancreatic Polypeptide Recombinant Rabbit Monoclonal Antibody [PSH0-84]
HA721515 100 µL

Pancreatic Polypeptide Recombinant Rabbit Monoclonal Antibody [PSH0-84]

Sign In for Pricing
View Details
HCN1 Human Gene Knockout Kit (CRISPR)
KN420956 1 Kit

HCN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sodium Fluoride
TRC-S627000-25G 25 g

Sodium Fluoride

Sign In for Pricing
View Details
(1S)-trans-Lambda-Cyhalothrin
TRC-L170005-5MG 5 mg

(1S)-trans-Lambda-Cyhalothrin

Sign In for Pricing
View Details
Trpc7 Mouse Gene Knockout Kit (CRISPR)
KN518296 1 Kit

Trpc7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details