Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C9orf4 (C9orf4)

This Recombinant Human Uncharacterized protein C9orf4 (C9orf4) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Uncharacterized protein C9orf4, Brain protein CG-6

UniProt

Q9P0K9

Expression Region

1-344

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRPRQGGGGAGGSAAARARAGGLGGGSVPARARGAPAAARAAWLRDLCARMARPPRQHP GVWASLLLLLLTGPAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGE FYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETCDYFLSYRMIG ADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRVRIQHFYNVGQWAKEIQRNP ARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYLFAWGPAIQGSITRHDIDSPPA SERVVSIYKYEDIFMPSAAYQTFSSPFCLLLIVALTFYLLMGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN1B (NM_001037) Human Over-expression Lysate
LY422145 100 µg

SCN1B (NM_001037) Human Over-expression Lysate

Sign In for Pricing
View Details
Yipf3 Mouse Gene Knockout Kit (CRISPR)
KN519551 1 Kit

Yipf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PAX5/3735), CF740 conjugate, 0.1mg/mL
BNC743735-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PAX5/3735), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APOBEC4 Mouse Monoclonal Antibody [Clone ID: OTI2C1]
CF810853 100 µg

APOBEC4 Mouse Monoclonal Antibody [Clone ID: OTI2C1]

Sign In for Pricing
View Details
beta Tubulin Recombinant Mouse Monoclonal Antibody [1-B11-R]
HA601147 100 µL

beta Tubulin Recombinant Mouse Monoclonal Antibody [1-B11-R]

Sign In for Pricing
View Details
5-Carboxyvanillic Acid
TRC-C183315-500MG 500 mg

5-Carboxyvanillic Acid

Sign In for Pricing
View Details