Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hemolysin BL-binding component (hblA)

This Recombinant Hemolysin BL-binding component (hblA) spans the amino acid sequence from region 32-375.

Product Specifications

Product Name Alternative

Hemolysin BL-binding component, Enterotoxin 40 kDa subunit

UniProt

P80172

Expression Region

32-375

Origin

Bacillus cereus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEIEQTNNGDTALSANEAKMKETLQKAGLFAKSMNAYSYMLIKNPDVNFEGITINGYVDL PGRIVQDQKNARAHAVTWDTKVKKQLLDTLTGIVEYDTTFDNYYETMVEAINTGDGETLK EGITDLRGEIQQNQKYAQQLIEELTKLRDSIGHDVRAFGSNKELLQSILKNQGADVDADQ KRLEEVLGSVNYYKQLESDGFNVMKGAILGLPIIGGIIVGVARDNLGKLEPLLAELRQTV DYKVTLNRVVGVAYSNINEIDKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKAD QNKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIKELKVETVTPQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAF2 Protein Vector (Mouse) (pPM-C-HA)
PV247948 500 ng

YAF2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Nalgene CN 0.45um 250ml Analytical Funnel
FIL8230 50 / PCK

Nalgene CN 0.45um 250ml Analytical Funnel

Sign In for Pricing
View Details
Caspase 14 Antibody, mAb, Rabbit
A03355-50 50 µL

Caspase 14 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
NCK2 siRNA (Mouse)
orb1846566-01 15 nmol

NCK2 siRNA (Mouse)

Sign In for Pricing
View Details
NCK2 siRNA (Mouse)
orb1846566-02 30 nmol

NCK2 siRNA (Mouse)

Sign In for Pricing
View Details
Recombinant Human CD4 Protein
ARP1511-01 10 µg

Recombinant Human CD4 Protein

Sign In for Pricing
View Details