Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hemolysin BL-binding component (hblA)

This Recombinant Hemolysin BL-binding component (hblA) spans the amino acid sequence from region 32-375.

Product Specifications

Product Name Alternative

Hemolysin BL-binding component, Enterotoxin 40 kDa subunit

UniProt

P80172

Expression Region

32-375

Origin

Bacillus cereus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEIEQTNNGDTALSANEAKMKETLQKAGLFAKSMNAYSYMLIKNPDVNFEGITINGYVDL PGRIVQDQKNARAHAVTWDTKVKKQLLDTLTGIVEYDTTFDNYYETMVEAINTGDGETLK EGITDLRGEIQQNQKYAQQLIEELTKLRDSIGHDVRAFGSNKELLQSILKNQGADVDADQ KRLEEVLGSVNYYKQLESDGFNVMKGAILGLPIIGGIIVGVARDNLGKLEPLLAELRQTV DYKVTLNRVVGVAYSNINEIDKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKAD QNKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIKELKVETVTPQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAB39 3'UTR Luciferase Stable Cell Line
TU003339 1.0 mL

CAB39 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Benzyl 2,3,4-Tri-O-acetyl-4-nitromethyl-β-D-arabinopyranoside
TSW-00587-01 100 mg

Benzyl 2,3,4-Tri-O-acetyl-4-nitromethyl-β-D-arabinopyranoside

Sign In for Pricing
View Details
Benzyl 2,3,4-Tri-O-acetyl-4-nitromethyl-β-D-arabinopyranoside
TSW-00587-02 250 mg

Benzyl 2,3,4-Tri-O-acetyl-4-nitromethyl-β-D-arabinopyranoside

Sign In for Pricing
View Details
Benzyl 2,3,4-Tri-O-acetyl-4-nitromethyl-β-D-arabinopyranoside
TSW-00587-03 50 mg

Benzyl 2,3,4-Tri-O-acetyl-4-nitromethyl-β-D-arabinopyranoside

Sign In for Pricing
View Details
Lentiviral human ZBTB7B shRNA (UAS) - Lentiviral human ZBTB7B shRNA (UAS) (25)
GTR15142817 1 Vial

Lentiviral human ZBTB7B shRNA (UAS) - Lentiviral human ZBTB7B shRNA (UAS) (25)

Sign In for Pricing
View Details
Anti-DNA, Intercalated, Antibody
orb1148516-01 100 µg

Anti-DNA, Intercalated, Antibody

Sign In for Pricing
View Details