Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hemolysin BL-binding component (hblA)

This Recombinant Hemolysin BL-binding component (hblA) spans the amino acid sequence from region 32-375.

Product Specifications

Product Name Alternative

Hemolysin BL-binding component, Enterotoxin 40 kDa subunit

UniProt

P80172

Expression Region

32-375

Origin

Bacillus cereus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEIEQTNNGDTALSANEAKMKETLQKAGLFAKSMNAYSYMLIKNPDVNFEGITINGYVDL PGRIVQDQKNARAHAVTWDTKVKKQLLDTLTGIVEYDTTFDNYYETMVEAINTGDGETLK EGITDLRGEIQQNQKYAQQLIEELTKLRDSIGHDVRAFGSNKELLQSILKNQGADVDADQ KRLEEVLGSVNYYKQLESDGFNVMKGAILGLPIIGGIIVGVARDNLGKLEPLLAELRQTV DYKVTLNRVVGVAYSNINEIDKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKAD QNKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIKELKVETVTPQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3j Antibody
orb805169 2 mg

EIF3j Antibody

Sign In for Pricing
View Details
(R) -1- (Isopropyl (methyl) amino) propan-2-yl) carbamic Acid tert-Butyl Ester
463649-01 10 mg

(R) -1- (Isopropyl (methyl) amino) propan-2-yl) carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
(R) -1- (Isopropyl (methyl) amino) propan-2-yl) carbamic Acid tert-Butyl Ester
463649-02 25 mg

(R) -1- (Isopropyl (methyl) amino) propan-2-yl) carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
TorD Antibody
orb833951 2 mg

TorD Antibody

Sign In for Pricing
View Details
BAG5 peptide
orb218263-01 1 mg

BAG5 peptide

Sign In for Pricing
View Details
BAG5 peptide
orb218263-02 5 mg

BAG5 peptide

Sign In for Pricing
View Details