Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas sp. Lipase chaperone (lifO)

This Recombinant Pseudomonas sp. Lipase chaperone (lifO) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Lipase chaperone, Lipase activator protein, Lipase foldase, Lipase helper protein, Lipase modulator, Transcriptional activator act

UniProt

P25276

Expression Region

1-344

Origin

Pseudomonas sp. (strain KWI-56)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSREGRAPLARRAVVYGVVGLAAIAGVAMWSGAGWHRATGASGESPEASVAGGSVTAPP QAAVPASTGLPPSLAGSSAPRLPLDAGGHLAKSRAVRDFFDYCLTAQSDLSAAGLDAFVM REIAAQLDGTVAQAEALDVWHRYRAYLDALAKLRDAGAADKSDLGALQLALDQRASIAYR TLGDWSQPFFGAEQWRQRYDLARLKIAQDPTLTDAQKAERLAALEQQMPADERAAQQHID QQRAAIDQIAQLQKSGATPDAMRAQLTQTLGPEAAARVAQMQQDDASWQSRYADYAAQRT QIESAGLSPQDRDAQIAALRQRVFTRPGEAVRAASLDRGAGSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF568 conjugate, 0.1mg/mL
BNC680484-500 1x 500 µL

Progesterone Receptor (PR484), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF488A conjugate, 0.1mg/mL
BNC881828-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details