Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquifex aeolicus Uncharacterized protein aq_1917 (aq_1917)

This Recombinant Aquifex aeolicus Uncharacterized protein aq_1917 (aq_1917) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Uncharacterized protein aq_1917

UniProt

O67748

Expression Region

1-345

Origin

Aquifex aeolicus (strain VF5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAQAGFDTFIEATRYLFRGPSPQEILLLIIVLGALITVVSLPFFYSKLKEKQRIRENFF RRARDFDLTEEEASVLWKYVKETVLNPNLVFENKAVFEKVVDRIVQNGNPEEIKLISSIR MKLRFSSLPWFIPLTSTRDIEVYQTGVLVVRNRRVDAYVYDKDEEFLYIALLEPVVVKPG ERVSFFFLRENDARYSFDATVEKVFNEGGRTVIVVRHTSEIKRIQLRESVRWKVKLPVKF TLLKENGEEINAEGQLEDISVKGARVCFEGRLDIKEGDRILLDFTLKNYTFKNLLGTVVH QIVYEKRTCLGIKFEELSRKEEEVIGQFILEEQRKLLKAYKEGEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-100 1x 100 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-100 1x 100 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-500 1x 500 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2398), CF568 conjugate, 0.1mg/mL
BNC682398-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/2398), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details