Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv1841c/MT1889 (Rv1841c, MT1889)

This Recombinant Uncharacterized protein Rv1841c/MT1889 (Rv1841c, MT1889) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv1841c/MT1889

UniProt

Q50593

Expression Region

1-345

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLSAVLLALLLIGANAFFVGAEFALISARRDRLEALAEQGKATAVTVIRAGEQLPAML TGAQLGVTVSSILLGRVGEPAVVKLLQLSFGLSGVPPALLHTLSLAIVVALHVLLGEMVP KNIALAGPERTAMLLVPPYLVYVRLARPFIAFYNNCANAILRLVGVQPKDELDIAVSTAE LSEMIAESLSEGLLDHEEHTRLTRALRIRTRLVADVAVPLVNIRAVQVSAVGSGPTIGGV EQALAQTGYSRFPVVDRGGRFIGYLHIKDVLTLGDNPQTVIDLAVVRPLPRVPQSLPLAD ALSRMRRINSHLALVTADNGSVVGMVALEDVVEDLVGTMRDGTHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
BNC880806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-100 1x 100 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details