Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b)

This Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 109B

UniProt

Q810S1

Expression Region

1-345

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGALSGRRMLPSGLCLGRWQLLRTIRARGRGDPRELPSTPQVLCMKLYGNPKYHQALHY GTVEPQDEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAA IITADGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEEPSGEHMTELENTKSLVHRL FTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEARSEANTSGLLWAGLALLSVQ GGALAWLTWWVYSWDIMEPVTFFLSFANSIVFFAYFIITRQNYTYSSLRSRQFLQFFHKK SQRRCFDVEQYNKLKEDLAEATESLESVRRSLRLRIQGEEASEKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NETO2 activation kit by CRISPRa
GA113125 1 Kit

Human NETO2 activation kit by CRISPRa

Sign In for Pricing
View Details
Involucrin (SY5) AC
sc-21748 AC 500 µg/mL - 25% ag

Involucrin (SY5) AC

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), Biotin conjugate, 0.1mg/mL
BNCB2200-500 1x 500 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Necab1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3311007 1.0 µg DNA

Necab1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
FURIN (NM_002569) Human Tagged ORF Clone Lentiviral Particle
RC204279L1V 200 µL

FURIN (NM_002569) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RARRES1 Rabbit Polyclonal Antibody (HRP)
orb479774 100 µL

RARRES1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details